PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G2022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 450aa    MW: 48240.7 Da    PI: 7.6683
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G2022genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.76.9e-15238293358
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  + kr+rr+ +NRe+ArrsR+RK+a++ eLe+ v +L ae ++L k+l  ++ ++++
  Gh_D08G2022 238 DAKRARRMRSNRESARRSRRRKQAQMNELETQVGQLRAEHSSLLKRLTDMNHKYDE 293
                  68****************************************99888777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.4E-12235290No hitNo description
SMARTSM003387.3E-18236300IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323238293IPR004827Basic-leucine zipper domain
PfamPF001701.9E-12239292IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.91E-10240290No hitNo description
PROSITE patternPS000360243258IPR004827Basic-leucine zipper domain
PfamPF124981.3E-18307414IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MVERQEKQDQ TQIANRRGKK ISLKTMNSVF SVDDFSDPFW VASATGAAAG MSRSQSEWAL  60
EKFLEEFSGA GAAIQGSRAG ENVIGTSLAA PQAPVSKSEN GDGDGGAVEV KKPNNLNPPP  120
SDSTPTVPID ADEYRAILKN KLHQACAAVA LSRASAVKAE GSSAQAENQA LQSGSYVQGS  180
SKTQEQGEPD AGISAVSTTQ KKSGTQMRQA TSGSSREDSD DGELEGDTET TENMDPADAK  240
RARRMRSNRE SARRSRRRKQ AQMNELETQV GQLRAEHSSL LKRLTDMNHK YDEAAVDNRI  300
LKADIETLRA KVKMAEETVK RVTGLNPVLL SRPSVPSVPV PFVSSPLESS TGSMPLPPNT  360
SKLFHQPVPD IAAPIHHPRL DNSFTGNNLV TPIVNPQTEI GVENVNKTSA LQHTPRGVQK  420
QIGPCVSPCV PMPGWEPGLP HGAATNNKQS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252259RRSRRRKQ
2254259SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.96950.0boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476236.10.0PREDICTED: basic leucine zipper 10-like
SwissprotO227632e-75BZP10_ARATH; Basic leucine zipper 10
TrEMBLA0A0D2R2090.0A0A0D2R209_G
STRINGPOPTR_0005s23900.19e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.22e-54bZIP family protein